Kocuria marina subsp. indica: KocCE7_01715 Help Entry KocCE7_01715      CDS       T05866                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism kii  Kocuria marina subsp. indica Brite KEGG Orthology (KO) [BR:kii00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:kii03032]     KocCE7_01715    03036 Chromosome and associated proteins [BR:kii03036]     KocCE7_01715    03400 DNA repair and recombination proteins [BR:kii03400]     KocCE7_01715 DNA replication proteins [BR:kii03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     KocCE7_01715 Chromosome and associated proteins [BR:kii03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     KocCE7_01715 DNA repair and recombination proteins [BR:kii03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       KocCE7_01715 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF2267 Motif Other DBs NCBI-ProteinID:  QBJ20715 LinkDB All DBs Position 396031..396315 Genome browser AA seq 94 aa AA seqDB search MAMNRSELVAEVAEKSGSTQAAVNGVLDSLFQVFESSVSKGEKITIPGWLSVERTDRAAR QGRNPQTGEAIQIPAGHGVKLTAGSKLKAAVSSK NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggctatgaaccgcagcgaactcgtcgcagaggttgccgagaagtccggtagcacccag gccgccgtcaacggcgttctcgactccctgttccaggttttcgagagctccgtttccaag ggcgagaagatcaccatccccggctggctctccgtggagcgcaccgaccgcgccgcacgt cagggtcgcaacccgcaaaccggcgaggccatccagatcccggctggccacggtgtcaag ctcaccgcgggctccaagctgaaggctgctgtttcctccaagtga

DBGET integrated database retrieval system