Kineobactrum salinum: G3T16_02305 Help Entry G3T16_02305       CDS       T06468                                  Symbol ccmD Name (GenBank) heme exporter protein CcmD   KO K02196   heme exporter protein D Organism kim  Kineobactrum salinum Pathway kim02010   ABC transporters Brite KEGG Orthology (KO) [BR:kim00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     G3T16_02305 (ccmD)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:kim02000]     G3T16_02305 (ccmD) Transporters [BR:kim02000]  ABC transporters, prokaryotic type   ABC-2 type and other transporters    Heme transporter     G3T16_02305 (ccmD) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CcmD Motif Other DBs NCBI-ProteinID:  QIB64407 UniProt:  A0A6C0U0A6 LinkDB All DBs Position complement(511149..511364) Genome browser AA seq 71 aa AA seqDB search MYFESLAAALAMDGHGAFVWSAYLITLVVVVFMLYLPRHREKQILRRLEGQHRRDSRAAP PPTRSSDASGS NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgtatttcgaatcgctggcggcagcgctggcaatggatggccacggtgccttcgtctgg tcggcctacctgattaccctggtagtggttgtgttcatgctgtacttgccccggcatcgc gagaagcagatactgcgccggcttgaaggccagcacagacgggacagcagggcagcgccc ccacccacaaggagctctgatgcatccggttcgtaa

DBGET integrated database retrieval system