Kineobactrum salinum: G3T16_04105 Help Entry G3T16_04105       CDS       T06468                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kim  Kineobactrum salinum Pathway kim01100   Metabolic pathways kim01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kim00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G3T16_04105    00074 Mycolic acid biosynthesis     G3T16_04105   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G3T16_04105 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QIB64693 UniProt:  A0A6C0TYS3 LinkDB All DBs Position 941229..941480 Genome browser AA seq 83 aa AA seqDB search MQALELTQSLVRSCLNLSETEPLSADTYLMGGFPEFDSLTITTLITRIEEAIGCEIDDDE ISGETFETVGTLAEFVSQKMEQG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgcaagcacttgaactgacccagagcctggttcgttcctgcctcaacctgagcgaaact gagccactgtcagcagatacctatctcatgggcggctttcccgaattcgattccctgacc atcactaccctgatcacgcggattgaggaagcgatcggctgcgagatcgacgacgacgag atcagcggcgagacgttcgagacagtaggtacgctggctgaattcgtgagccagaagatg gaacagggctga

DBGET integrated database retrieval system