Kineobactrum salinum: G3T16_18500
Help
Entry
G3T16_18500 CDS
T06468
Name
(GenBank) UTRA domain-containing protein
KO
K05836
GntR family transcriptional regulator, histidine utilization repressor
Organism
kim
Kineobactrum salinum
Brite
KEGG Orthology (KO) [BR:
kim00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03000 Transcription factors [BR:
kim03000
]
G3T16_18500
Transcription factors [BR:
kim03000
]
Prokaryotic type
Helix-turn-helix
GntR family
G3T16_18500
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
UTRA
GntR
HTH_Crp_2
HTH_20
HTH_IclR
MarR
MarR_2
HTH_24
TrmB
HTH_29
HTH_12
RP-C
Crp
HTH_23
HTH_36
HTH_11
Fe_dep_repress
HTH_7
HTH_DeoR
HTH_41
HTH_OrfB_IS605
DUF4423
Motif
Other DBs
NCBI-ProteinID:
QIB67087
UniProt:
A0A6C0U7W6
LinkDB
All DBs
Position
4189959..4190660
Genome browser
AA seq
233 aa
AA seq
DB search
MSACPPRTWQSVRDEVLARIHRREWAPGALIPGEAALAREFGCARATVNRALQALAESGL
LERRRRAGTRVTALPVRRATLEIPVIRREIEATGARYSLRLLENTSALAPTALREQLGLP
AGTKMQHLRTLHLADGCPHVYEDRWLNPERLPALTEVDLRQLSINEWLVENVPFTRGDFS
FAACSASADVAALLDCAPATALLLVQRSTWQHDAVITAVQLYYRPGYCIRTQL
NT seq
702 nt
NT seq
+upstream
nt +downstream
nt
gtgagcgcttgtccgccccgcacctggcaatcggtcagggatgaagtactggcgcggatc
caccgccgggaatgggctccgggtgcgctgattcctggagaggcggcgctggcgcgggaa
tttggctgtgcccgcgccaccgtgaaccgggccctgcaggcgctggcggaaagcggcctg
ttggagcgccgccgccgggcggggacccgggtgacggcactgcccgtacgcagggcgacc
ctggaaattccggttatccgccgggaaatcgaagccactggcgcccgctattccctccgg
ctgctggaaaacaccagcgcgctggcgcccacggcgctgcgcgagcagttgggactgccc
gccgggacgaagatgcagcacctgcgcacgctgcacctggcggacggttgcccccacgtc
tatgaagatcgctggctgaatccggagcgactgccggcattgacggaggtggatcttcgg
cagctcagcatcaacgagtggttggtggagaatgtcccctttacccgcggcgatttcagt
tttgccgcttgcagtgccagcgctgatgtcgcggctttgctggactgtgcgccggccacc
gcgctgttgctggtgcagcgtagcacctggcagcacgacgcggtgataaccgcggtgcaa
ttgtactaccgaccgggttactgcatccgtacgcagctctag
DBGET
integrated database retrieval system