Kitasatospora sp. NA04385: HUT16_23695 Help Entry HUT16_23695       CDS       T08635                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism kis  Kitasatospora sp. NA04385 Pathway kis00253   Tetracycline biosynthesis kis01056   Biosynthesis of type II polyketide backbone kis01100   Metabolic pathways kis01110   Biosynthesis of secondary metabolites Module kis_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:kis00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     HUT16_23695    00253 Tetracycline biosynthesis     HUT16_23695  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:kis01004]     HUT16_23695    01008 Polyketide biosynthesis proteins [BR:kis01008]     HUT16_23695 Lipid biosynthesis proteins [BR:kis01004]  Polyketide synthase   Component type    HUT16_23695 Polyketide biosynthesis proteins [BR:kis01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      HUT16_23695     Nonaketide PKS      HUT16_23695     Decaketide PKS      HUT16_23695 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  QKW21662 UniProt:  A0A7H8KZS2 LinkDB All DBs Position 5299310..5299579 Genome browser AA seq 89 aa AA seqDB search MSQMTLDELTTLLRECAGEDESVDLSGDVLDTPLDDLGYDSLAVLQTTGRIEREYDIELA EDTVAEAHTPRLLLEFINASLAEQAAVAA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtcccagatgaccctggacgagctgaccaccctgctgcgcgagtgcgcgggcgaggac gagagcgtcgacctcagcggcgacgtcctcgacaccccgctggacgacctcggctacgac tcgctggcggtcctgcagaccaccggccggatcgagcgcgagtacgacatcgagctggcc gaggacaccgtcgccgaggcccacaccccgcgcctgctgctggagttcatcaacgccagc ctcgccgagcaggccgccgtcgccgcctga

DBGET integrated database retrieval system