Kitasatospora sp. MMS16-BH015: CFP65_4142 Help Entry CFP65_4142        CDS       T05366                                  Name (GenBank) Acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism kit  Kitasatospora sp. MMS16-BH015 Pathway kit00253   Tetracycline biosynthesis kit01056   Biosynthesis of type II polyketide backbone kit01100   Metabolic pathways kit01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kit00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     CFP65_4142    00253 Tetracycline biosynthesis     CFP65_4142  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:kit01004]     CFP65_4142    01008 Polyketide biosynthesis proteins [BR:kit01008]     CFP65_4142 Lipid biosynthesis proteins [BR:kit01004]  Polyketide synthase   Component type    CFP65_4142 Polyketide biosynthesis proteins [BR:kit01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      CFP65_4142     Nonaketide PKS      CFP65_4142     Decaketide PKS      CFP65_4142 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AUG78897 LinkDB All DBs Position 4830045..4830311 Genome browser AA seq 88 aa AA seqDB search MSEFTLSELTDKLRECAGDPAEGYDLDRDDVTDVLFFDLGYDSLALLQVTGVLKRERGVV LRDDEVMGVETPRELLQLINADLSVRAA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgagtgagttcaccctgtccgagctgaccgacaagctgcgcgagtgcgcgggcgatccc gccgagggctacgacctggaccgcgacgacgtcacggacgtcctgttcttcgacctcggt tacgactccctggcgctgctccaggtcaccggggtgctcaagcgggagcgcggcgtcgtg ctgcgggacgacgaggtgatgggcgtggagacccccagggagctgctccagctgatcaac gccgacctcagcgtgcgggccgcctga

DBGET integrated database retrieval system