Kingella kingae: KKKWG1_0457 Help Entry KKKWG1_0457       CDS       T04151                                  Symbol acpP Name (GenBank) acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism kki  Kingella kingae Pathway kki01100   Metabolic pathways kki01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kki00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KKKWG1_0457 (acpP)    00074 Mycolic acid biosynthesis     KKKWG1_0457 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KKKWG1_0457 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  CRZ19631 LinkDB All DBs Position I:complement(430981..431214) Genome browser AA seq 77 aa AA seqDB search MSIEQKVKSIVAEQLGVNEAEVKNESSFQDDLGADSLDTVELVMALEEAFGCEIPDEDAE KITTVQAAIDYVNAKQG NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtctatcgaacaaaaagtaaaaagcatcgttgccgaacaattaggcgttaacgaagcc gaagtaaaaaacgaatcttctttccaagacgacttgggtgcagattctttggacaccgtt gaattggttatggctttggaagaagcatttggctgcgaaatccctgacgaagacgcagaa aaaatcacaaccgttcaagcagcgattgactatgtaaacgcaaaacaaggctaa

DBGET integrated database retrieval system