Kangiella koreensis: Kkor_2478 Help Entry Kkor_2478         CDS       T00973                                  Name (GenBank) conserved hypothetical protein   KO K02078   acyl carrier protein Organism kko  Kangiella koreensis Pathway kko01100   Metabolic pathways kko01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kko00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Kkor_2478    00074 Mycolic acid biosynthesis     Kkor_2478   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Kkor_2478 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  ACV27887 UniProt:  C7R997 LinkDB All DBs Position complement(2671573..2671836) Genome browser AA seq 87 aa AA seqDB search MAYQTNIDKMIVLLSETLSIDADQLSAETLLLGNLPEFDSMAIVSILMQIEESFAIEISD DELTGEIFESVTTLTEFVEVQQAATAI NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggcataccagaccaacatcgataaaatgatagtcttgctaagcgagaccttatcgatt gatgccgatcagttgtcggcagagactttgctgctgggtaatttgccggagtttgattca atggcgattgtttccattttgatgcagatcgaagaaagctttgccatcgaaatttcagat gatgagttgactggcgagatctttgagtccgtaaccacccttacggagtttgtggaagta cagcaggcagccacagcaatttag

DBGET integrated database retrieval system