Kluyveromyces lactis: KLLA0_B03476g Help Entry KLLA0_B03476g     CDS       T01025                                  Name (RefSeq) uncharacterized protein   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism kla  Kluyveromyces lactis Pathway kla03020   RNA polymerase kla03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:kla00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     KLLA0_B03476g   09124 Replication and repair    03420 Nucleotide excision repair     KLLA0_B03476g  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:kla03021]     KLLA0_B03476g    03400 DNA repair and recombination proteins [BR:kla03400]     KLLA0_B03476g Transcription machinery [BR:kla03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      KLLA0_B03476g   RNA polymerase III system    RNA polymerase III      KLLA0_B03476g   RNA polymerase I system    RNA polymerase I      KLLA0_B03476g DNA repair and recombination proteins [BR:kla03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       KLLA0_B03476g BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb6 Patatin Motif Other DBs NCBI-GeneID:  2896933 NCBI-ProteinID:  XP_451689 UniProt:  Q6CWK0 LinkDB All DBs Position B:join(315833..315852,315984..316440) Genome browser AA seq 158 aa AA seqDB search MSDNEGAFNDGPENYEDFDQEHFSDYDGFDEGEGKFGDENGLGTDENGNTIVAGGFGPEE FQQQEARRRRTLKEKAIAKEDRTTTPYMTKYERARILGTRALQISMNAPVFVDLEGETDP LRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL NT seq 477 nt NT seq  +upstreamnt  +downstreamnt atgtcagacaacgagggagcatttaatgacggtccagagaactatgaagattttgaccaa gagcatttctcagattacgacggatttgatgagggcgagggtaagtttggcgatgagaac ggattaggcacagatgaaaacgggaacacgatagttgctggaggatttggtccagaagag ttccagcaacaggaggctcgtcggagaagaactttgaaggagaaggctatcgccaaggaa gatagaactacaacaccatacatgacaaagtacgaaagagccagaattttaggtaccaga gccttgcaaatatctatgaacgcaccagtgttcgttgacttggaaggtgaaaccgaccca ttgagaatcgctatgaaagaattagcagagaagaagataccattggtcatcagaagatat cttcctgatggatcgttcgaagattggtcggttgaagaacttatcgtggacttgtag

DBGET integrated database retrieval system