Kluyveromyces lactis: KLLA0_B09284g Help Entry KLLA0_B09284g     CDS       T01025                                  Name (RefSeq) uncharacterized protein   KO K11368   enhancer of yellow 2 transcription factor Organism kla  Kluyveromyces lactis Brite KEGG Orthology (KO) [BR:kla00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:kla03021]     KLLA0_B09284g    03019 Messenger RNA biogenesis [BR:kla03019]     KLLA0_B09284g    03036 Chromosome and associated proteins [BR:kla03036]     KLLA0_B09284g Transcription machinery [BR:kla03021]  Eukaryotic type   RNA polymerase II system    Coactivators     SAGA/TFTC/STAGA complex      KLLA0_B09284g Messenger RNA biogenesis [BR:kla03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      KLLA0_B09284g Chromosome and associated proteins [BR:kla03036]  Eukaryotic type   Histone modification proteins    HAT complexes     SAGA complex      KLLA0_B09284g BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EnY2 Phage_ssDNA_bind Motif Other DBs NCBI-GeneID:  2897327 NCBI-ProteinID:  XP_451942 UniProt:  Q6CVU7 LinkDB All DBs Position B:complement(817377..817667) Genome browser AA seq 96 aa AA seqDB search MKYFNGLFSIFFFLLLTNYLNFNSRISNQLNQMLLDDGWIDKVKQLTREEMERSDSTNFV DILNKVEPQALNMVNDKTRTEILQTIKEFLNDIVEV NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaaatacttcaatgggttattctcaatctttttttttcttttactgacaaactattta aactttaactcaaggatatcgaatcaactaaaccagatgttattggacgatgggtggatc gacaaagtaaaacaactaacgagagaagagatggaaagaagtgacagtacaaatttcgtg gatattttaaataaagtcgagccccaggctcttaatatggtaaatgacaaaacgagaact gagatactacagacgataaaagagtttctaaatgacatagtagaggtctaa

DBGET integrated database retrieval system