Kluyveromyces lactis: KLLA0_E02575g Help Entry KLLA0_E02575g     CDS       T01025                                  Name (RefSeq) uncharacterized protein   KO K12625   U6 snRNA-associated Sm-like protein LSm6 Organism kla  Kluyveromyces lactis Pathway kla03018   RNA degradation kla03040   Spliceosome Brite KEGG Orthology (KO) [BR:kla00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     KLLA0_E02575g   09123 Folding, sorting and degradation    03018 RNA degradation     KLLA0_E02575g  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:kla03019]     KLLA0_E02575g    03041 Spliceosome [BR:kla03041]     KLLA0_E02575g Messenger RNA biogenesis [BR:kla03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      KLLA0_E02575g   mRNA degradation factors    5'-3' decay     Lsm complex      KLLA0_E02575g Spliceosome [BR:kla03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     KLLA0_E02575g SSDB OrthologParalogGFIT Motif Pfam:  LSM LSM14 SM-ATX Motif Other DBs NCBI-GeneID:  2894269 NCBI-ProteinID:  XP_454062 UniProt:  Q6CPS7 LinkDB All DBs Position E:complement(233160..233402) Genome browser AA seq 80 aa AA seqDB search MESKATASGSFLENIIGKPVYVKLFSGILYQGKLESIDGFMNVTMSQVSEHYEAEENGTL HKYPSEVFLRGSQVLYISEK NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggaatctaaggcaacggcttctggctcctttttggagaacatcattggaaaaccagta tacgtcaagctattctcaggaatattgtatcaaggtaagctagaatcaattgatgggttt atgaacgtcacaatgtcacaagtgtcggaacattatgaggcagaagagaacggaactttg cataaatatccttctgaagtatttctaaggggatcgcaggtgttatacattagcgaaaaa tag

DBGET integrated database retrieval system