KEGG   Enterobacter lignolyticus G5: AO703_00525
Entry
AO703_00525       CDS       T04198                                 
Name
(GenBank) acetolactate synthase catalytic subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
kle  Enterobacter lignolyticus G5
Pathway
kle00290  Valine, leucine and isoleucine biosynthesis
kle00650  Butanoate metabolism
kle00660  C5-Branched dibasic acid metabolism
kle00770  Pantothenate and CoA biosynthesis
kle01100  Metabolic pathways
kle01110  Biosynthesis of secondary metabolites
kle01210  2-Oxocarboxylic acid metabolism
kle01230  Biosynthesis of amino acids
Module
kle_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
kle_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:kle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AO703_00525
   00660 C5-Branched dibasic acid metabolism
    AO703_00525
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    AO703_00525
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AO703_00525
Enzymes [BR:kle01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     AO703_00525
SSDB
Motif
Pfam: TPP_enzyme_C TPP_enzyme_M TPP_enzyme_N POR_N XFP_N
Other DBs
NCBI-ProteinID: ALR74863
UniProt: A0A806X5W9
LinkDB
Position
117238..118884
AA seq 548 aa
MNGAQWVVHALRAQGVETVFGYPGGAIMPIYDALYDGGVEHLLCRHEQGAAMAAIGYARA
TGKTGVCMATSGPGATNLITGLADALLDSVPVVAITGQVASPFIGTDAFQEVDVLGLSLA
CTKHSFLVQSLEELPRVMAEAFQVANSGRPGPVLVDIPKDIQVAVGELEPHFSTVESDDV
FPHDDVQEARQMLAQAHKPMLYVGGGVGMAQAVPALREFIAVTQIPATCTLKGLGAVEAD
YPYYLGMLGMHGTKAANLAVQECDLLIAVGARFDDRVTGKLNTFAPNASVIHMDIDPAEL
NKLRQAHVALQGDLNALLPALQQPLAVDEWRQHTAAMRAEHAWRYDHPGDAIYAPLLLKQ
LSDRKPADSVVTTDVGQHQMWSAQHMTWNRPENFITSSGLGTMGFGLPAAVGAQVARPND
TVICISGDGSFMMNVQELGTVKRKQLPLKIVLLDNQRLGMVRQWQQLFFQERYSETTLTD
NPDFLTLASAFGIPGQHITRKDQVEAALDAMLSSEGPYLLHVSIDELENVWPLVPPGASN
AQMLEKLS
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgaatggggcacagtgggtggtacatgcgttgcgggcgcagggagtcgagacggtattc
ggctatccgggcggcgcgattatgccgatttacgatgcgttgtatgacggcggcgtggaa
cacctgctatgccggcacgagcagggcgctgcgatggcggcgatcggctatgcccgcgcc
acggggaaaaccggcgtatgcatggcgacctccggaccgggcgccaccaacctgatcacc
ggccttgccgatgcgctgctcgattccgttccggttgtcgcgatcaccggccaggtcgcc
tcgccgttcatcggtaccgacgctttccaggaagtggacgttctcggtttgtcgctggcc
tgcaccaagcacagctttcttgtgcagtcgctggaggagctgccccgcgtgatggcggag
gcgttccaggtggcgaactcaggccgccctggcccggtactggttgatattccgaaagat
atccaggtcgctgtcggcgagctggagccgcacttctccaccgttgaaagcgatgatgtt
ttcccgcatgacgatgtacaagaggctcgccagatgctggcgcaggcgcacaagccgatg
ctgtatgtcggtggcggcgtgggcatggcgcaggcggtgcctgcgctgcgtgaatttatc
gcggtgacgcaaataccggctacctgcacgctgaaggggctgggggccgtcgaggcggac
tacccgtattatctgggcatgctgggtatgcacggcacgaaagcggcgaacctggcggtg
caggagtgcgatttgctcattgccgtcggcgcccgttttgacgaccgcgtaaccggcaag
ctgaacaccttcgcgcccaatgccagcgttatccatatggatatcgacccggccgagctg
aacaaactgcgtcaggcgcatgtcgcgctgcagggcgatttgaatgcgctgctgccagcg
ctgcagcagccgctggccgttgatgaatggcgccagcatacggcggcaatgcgcgctgag
catgcctggcgctacgatcacccgggcgacgctatctatgcgccgctgctgttaaagcag
ctgtcggaccgtaaaccggcggacagcgtcgtcactaccgacgtcggccagcatcagatg
tggtcggcccagcacatgacctggaaccgtccggaaaactttattacctccagcggactg
ggcaccatgggcttcggcctgcctgcggcggttggcgcgcaggtggcgcgtccgaacgat
accgtgatctgcatctccggtgacggttcgttcatgatgaacgtccaggagctgggcacc
gtcaaacgaaaacagctgccgttgaaaatcgtcttactggataaccagcgattagggatg
gttcgccagtggcagcagctgtttttccaggaacgctatagcgaaaccaccctgaccgat
aaccccgatttcctcacgctggccagcgcctttggcatcccgggccagcacatcacccgt
aaagaccaggttgaagcggcactcgacgcaatgttgtccagcgaagggccgtacctgctt
catgtctcaatcgatgagcttgagaacgtctggccgttggtgccgcctggcgccagtaat
gcacaaatgctggagaaattatcatga

DBGET integrated database retrieval system