Klebsiella sp. LTGPAF-6F: BJF97_09050 Help Entry BJF97_09050       CDS       T05751                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism kll  Klebsiella sp. LTGPAF-6F Pathway kll00190   Oxidative phosphorylation kll01100   Metabolic pathways kll02020   Two-component system Module kll_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:kll00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BJF97_09050  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BJF97_09050 Enzymes [BR:kll01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      BJF97_09050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AOV11170 UniProt:  A0A1D8JR39 LinkDB All DBs Position 1953279..1953392 Genome browser AA seq 37 aa AA seqDB search MWYFAWILGTLLACAFGVITALALEHVEATKAGKEEH NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcatggattttgggaacgcttcttgcctgtgcttttggggtgattacc gcgctggcgcttgagcacgtggaagccaccaaagcaggtaaagaagaacactga

DBGET integrated database retrieval system