Klebsiella sp. M5al: BWI76_06540 Help Entry BWI76_06540       CDS       T09148                                  Name (GenBank) DNA-binding protein HU-beta   KO K03530   DNA-binding protein HU-beta Organism klm  Klebsiella sp. M5al Brite KEGG Orthology (KO) [BR:klm00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:klm03032]     BWI76_06540    03036 Chromosome and associated proteins [BR:klm03036]     BWI76_06540    03400 DNA repair and recombination proteins [BR:klm03400]     BWI76_06540 DNA replication proteins [BR:klm03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BWI76_06540 Chromosome and associated proteins [BR:klm03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BWI76_06540 DNA repair and recombination proteins [BR:klm03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BWI76_06540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  ARI07214 LinkDB All DBs Position 1375264..1375536 Genome browser AA seq 90 aa AA seqDB search MNKSQLIDKIAAGADISKAAAGRALDALIASVTESLQAGDDVALVGFGTFAVKERAARTG RNPQTGKEITIAAAKVPGFRAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaataaatctcaactgattgacaaaattgctgccggtgcggacatttctaaagccgca gctggacgtgcgttagatgctttaatcgcttctgttactgaatctctgcaggctggagat gacgttgcgctggtagggtttggtacttttgctgttaaagagcgcgctgcccgtactggt cgcaatccgcaaacaggcaaagaaatcaccattgctgctgctaaagttccgggtttccgc gcaggtaaagcgctgaaagacgcggtaaactga

DBGET integrated database retrieval system