Klebsiella sp. M5al: BWI76_11095 Help Entry BWI76_11095       CDS       T09148                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism klm  Klebsiella sp. M5al Pathway klm01100   Metabolic pathways klm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:klm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BWI76_11095    00074 Mycolic acid biosynthesis     BWI76_11095   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BWI76_11095 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  ARI08046 LinkDB All DBs Position 2340281..2340517 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttccttcgttgaagacctgggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcactactgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system