Pantoea rwandensis: LH22_15085 Help Entry LH22_15085        CDS       T03331                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kln  Pantoea rwandensis Pathway kln01100   Metabolic pathways kln01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kln00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LH22_15085    00074 Mycolic acid biosynthesis     LH22_15085   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LH22_15085 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AIR86722 UniProt:  A0A1X1CVW7 LinkDB All DBs Position complement(3204713..3204970) Genome browser AA seq 85 aa AA seqDB search MQALIDDIKLMIIDTLNLEDISPDDIETDAPLFGEGLGLDSIDALELGLAVKNRFGVQLS AESETLRAHFFSVATLAAFVEQQQA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcactgattgacgacatcaaactgatgattatcgacacgctgaatctggaagat atcagcccggacgatatagaaaccgacgcacccttgtttggcgaagggttgggactcgat tcaattgatgcccttgagctgggactggcggtgaaaaatcgcttcggcgtacagctttcc gcagaaagcgaaaccttacgcgcgcactttttttccgtggccacgctggccgcgtttgtt gaacaacagcaagcctga

DBGET integrated database retrieval system