KEGG   Klebsiella sp. MPUS7: GUC22_16770
Entry
GUC22_16770       CDS       T10508                                 
Name
(GenBank) xanthine permease XanP
  KO
K16345  xanthine permease XanP
Organism
klp  Klebsiella sp. MPUS7
Brite
KEGG Orthology (KO) [BR:klp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:klp02000]
    GUC22_16770
Transporters [BR:klp02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   GUC22_16770
SSDB
Motif
Pfam: Xan_ur_permease DUF7060
Other DBs
NCBI-ProteinID: QHI88463
LinkDB
Position
complement(3581417..3582799)
AA seq 460 aa
MSDEKNGGLLYGLEQRIPPLPAFFSALQHVLAGLVGIITPPLIIGAALGLGEWLPYLISM
SLLASGIGTFLQSNRVWGIGAGMICMQGTSFAFLGVAIAGGMWVKGQGGTPQDIMAMLFG
VNFVAALVPCLVSRFIEPLKRIFTPVITGSVIALIGISLIKVSVINWCGGEQAKAFASMS
NIALGAGTLGTIVLLSCAKNRWLRLSSVVVGIAVGCAAAALSGSFQLKGVGDVWFRLPQL
FPFGFQFNSAIFMPIALVSLVCILEAVGDLTANCLISQQSIDDEAFRSRLKGGILADGIS
CMVAAMLCAFPNTTFAQNNGVIQMTGVASRYVGRYIGGILILLGLFPPFGEILRQIPAPV
LGGATMVMFGCVVAAGIRIITQKPLTRRDMLIVGLAFGFGLGIEAVPAFLTQFPPIVGNL
FGSAATSGGLVAIVLNLIIPEEKPAAAAATRSTDDRAESL
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgtcagatgaaaaaaacggcggcttactgtacggcctcgagcagcggatcccgccgctc
ccggcattttttagcgctttacagcacgtactcgccgggctggtgggcatcatcacgccg
ccgctgattatcggcgcggcgctggggctgggggagtggctgccctatttaatcagcatg
tccctgctggcctccggcatcggtaccttcctgcaatccaaccgcgtttggggaatcggc
gcgggcatgatctgtatgcagggcaccagctttgcgttcctcggcgtcgccattgccggc
ggtatgtgggtaaaagggcagggcggcacgccgcaggatattatggccatgctgtttggc
gtcaacttcgtcgccgcgctggtgccctgtctcgtcagccgctttattgaaccgctgaag
cgtatttttaccccggtgattaccggcagcgtgattgcgctgatcggcattagcctgatt
aaagtcagcgtcattaactggtgcggcggcgagcaggcgaaagcgtttgccagcatgagc
aatatcgccctcggcgcgggtacgctggggaccatcgtcctgctgagctgtgcgaaaaac
cgctggctgcgcctctcttcggtggtggtggggattgccgtcggctgcgcggcggcggcg
ctgagcggatcgttccagcttaaaggcgtcggcgatgtctggttccgcttgccgcagctg
tttccgtttggttttcagtttaacagcgcgatttttatgccgattgcgctggtgtcgctg
gtctgcattcttgaggcggtgggggatctgacggctaactgcctgatctctcagcagtcg
atagatgacgaggccttccgttcccggctgaaaggcggcattcttgccgatggcataagc
tgcatggtggcggcgatgctgtgcgcgttccccaataccacctttgcgcaaaacaacggc
gtgattcagatgaccggcgtcgccagccgctacgttggccgctacattggggggattttg
attctgctgggcctgtttccgccgttcggcgagatactgcgccagatcccggcgccggtg
ctgggcggcgcgacgatggtgatgtttggctgcgtcgtggcggcggggatccgcattatc
acccagaaaccgctgacccgccgcgatatgctgatcgttggcctggcctttggttttggt
ctcggcattgaggcggtcccggcgtttctgacccaattcccgccgatcgtgggtaacctg
ttcggctcggcggcgaccagcggcgggctggtggcgattgtcctgaatctgattatcccg
gaagagaaaccggccgcggcggcggccacaaggagcaccgatgatcgcgctgaatcactt
taa

DBGET integrated database retrieval system