Klebsiella sp. MPUS7: GUC22_16770
Help
Entry
GUC22_16770 CDS
T10508
Name
(GenBank) xanthine permease XanP
KO
K16345
xanthine permease XanP
Organism
klp Klebsiella sp. MPUS7
Brite
KEGG Orthology (KO) [BR:
klp00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
klp02000
]
GUC22_16770
Transporters [BR:
klp02000
]
Other transporters
Electrochemical potential-driven transporters [TC:
2
]
GUC22_16770
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Xan_ur_permease
DUF7060
Motif
Other DBs
NCBI-ProteinID:
QHI88463
LinkDB
All DBs
Position
complement(3581417..3582799)
Genome browser
AA seq
460 aa
AA seq
DB search
MSDEKNGGLLYGLEQRIPPLPAFFSALQHVLAGLVGIITPPLIIGAALGLGEWLPYLISM
SLLASGIGTFLQSNRVWGIGAGMICMQGTSFAFLGVAIAGGMWVKGQGGTPQDIMAMLFG
VNFVAALVPCLVSRFIEPLKRIFTPVITGSVIALIGISLIKVSVINWCGGEQAKAFASMS
NIALGAGTLGTIVLLSCAKNRWLRLSSVVVGIAVGCAAAALSGSFQLKGVGDVWFRLPQL
FPFGFQFNSAIFMPIALVSLVCILEAVGDLTANCLISQQSIDDEAFRSRLKGGILADGIS
CMVAAMLCAFPNTTFAQNNGVIQMTGVASRYVGRYIGGILILLGLFPPFGEILRQIPAPV
LGGATMVMFGCVVAAGIRIITQKPLTRRDMLIVGLAFGFGLGIEAVPAFLTQFPPIVGNL
FGSAATSGGLVAIVLNLIIPEEKPAAAAATRSTDDRAESL
NT seq
1383 nt
NT seq
+upstream
nt +downstream
nt
atgtcagatgaaaaaaacggcggcttactgtacggcctcgagcagcggatcccgccgctc
ccggcattttttagcgctttacagcacgtactcgccgggctggtgggcatcatcacgccg
ccgctgattatcggcgcggcgctggggctgggggagtggctgccctatttaatcagcatg
tccctgctggcctccggcatcggtaccttcctgcaatccaaccgcgtttggggaatcggc
gcgggcatgatctgtatgcagggcaccagctttgcgttcctcggcgtcgccattgccggc
ggtatgtgggtaaaagggcagggcggcacgccgcaggatattatggccatgctgtttggc
gtcaacttcgtcgccgcgctggtgccctgtctcgtcagccgctttattgaaccgctgaag
cgtatttttaccccggtgattaccggcagcgtgattgcgctgatcggcattagcctgatt
aaagtcagcgtcattaactggtgcggcggcgagcaggcgaaagcgtttgccagcatgagc
aatatcgccctcggcgcgggtacgctggggaccatcgtcctgctgagctgtgcgaaaaac
cgctggctgcgcctctcttcggtggtggtggggattgccgtcggctgcgcggcggcggcg
ctgagcggatcgttccagcttaaaggcgtcggcgatgtctggttccgcttgccgcagctg
tttccgtttggttttcagtttaacagcgcgatttttatgccgattgcgctggtgtcgctg
gtctgcattcttgaggcggtgggggatctgacggctaactgcctgatctctcagcagtcg
atagatgacgaggccttccgttcccggctgaaaggcggcattcttgccgatggcataagc
tgcatggtggcggcgatgctgtgcgcgttccccaataccacctttgcgcaaaacaacggc
gtgattcagatgaccggcgtcgccagccgctacgttggccgctacattggggggattttg
attctgctgggcctgtttccgccgttcggcgagatactgcgccagatcccggcgccggtg
ctgggcggcgcgacgatggtgatgtttggctgcgtcgtggcggcggggatccgcattatc
acccagaaaccgctgacccgccgcgatatgctgatcgttggcctggcctttggttttggt
ctcggcattgaggcggtcccggcgtttctgacccaattcccgccgatcgtgggtaacctg
ttcggctcggcggcgaccagcggcgggctggtggcgattgtcctgaatctgattatcccg
gaagagaaaccggccgcggcggcggccacaaggagcaccgatgatcgcgctgaatcactt
taa
DBGET
integrated database retrieval system