Kluyvera sp. CRP: K7B04_13925 Help Entry K7B04_13925       CDS       T08589                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism klu  Kluyvera sp. CRP Pathway klu01100   Metabolic pathways klu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:klu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K7B04_13925    00074 Mycolic acid biosynthesis     K7B04_13925   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K7B04_13925 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding GshA MerR_2 Motif Other DBs NCBI-ProteinID:  UAK18445 LinkDB All DBs Position complement(2998809..2999060) Genome browser AA seq 83 aa AA seqDB search MNEQHAIYAEVSALLETLFEIDPQDIKPEARLYEDLELDSIDAIDMVVQLQKKVGKKIKP EEFKAVRTVQDVVDAVAGLLKEA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaacgaacaacacgcaatttacgccgaagtctccgcgctgctggagacgctgtttgag atagatccgcaggatattaagccggaagcccgtctgtatgaagaccttgagctggacagc attgacgctatcgatatggtcgtgcagctgcaaaaaaaggtcggtaaaaaaattaagccg gaagagttcaaagccgttcgtaccgtgcaggatgtggtcgatgcggtggccggcctgctg aaagaagcgtaa

DBGET integrated database retrieval system