Kluyvera sp. CRP: K7B04_20520 Help Entry K7B04_20520       CDS       T08589                                  Name (GenBank) DinI-like family protein   KO K12149   DNA-damage-inducible protein I Organism klu  Kluyvera sp. CRP Brite KEGG Orthology (KO) [BR:klu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:klu03400]     K7B04_20520 DNA repair and recombination proteins [BR:klu03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     K7B04_20520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI SRA1 Motif Other DBs NCBI-ProteinID:  UAK19654 LinkDB All DBs Position complement(4327867..4328100) Genome browser AA seq 77 aa AA seqDB search MKVEVTIDKTKKLPTGAEAALQTELLRRLNQSFEDCRLIVRRAGSDGLSVIGGADGDKKR VEEILQETWESADDWFY NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgaaagttgaagtgacgatcgacaaaaccaaaaaactgcccactggcgcagaagccgcg ctgcaaactgagctgcttcgccgcctgaatcagagctttgaagattgccggttgattgtg cgccgcgcgggttctgatggcctcagcgttatcggtggcgcagatggcgacaaaaagcga gtagaggaaatcctgcaggaaacgtgggaaagcgcagacgactggttttattaa

DBGET integrated database retrieval system