Klebsiella huaxiensis: DA718_01830 Help Entry DA718_01830       CDS       T05915                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism klw  Klebsiella huaxiensis Pathway klw01100   Metabolic pathways klw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:klw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DA718_01830    00074 Mycolic acid biosynthesis     DA718_01830   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DA718_01830 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QBG11000 LinkDB All DBs Position complement(397800..398057) Genome browser AA seq 85 aa AA seqDB search MQALYLEIKNLIINTLNLDELSADDIDTEAALFGDGLGLDSIDALELGLAVKNQYGVVLS AESEEMRQHFFSVATLASFIHAQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgctctatcttgaaattaaaaatttgattatcaacacattgaacctggacgaa ctgtccgctgacgatatcgacactgaagcagcgctgtttggcgatggtctgggtctggac tcaatcgatgctctggagctcggtctggcagtgaaaaaccagtatggcgtggtgctgtcg gctgagagcgaagagatgcgccaacacttcttttccgtcgccacgctggcatctttcatt cacgcgcaacgtgcctga

DBGET integrated database retrieval system