Klebsiella sp. PCX: GQR96_01855 Help Entry GQR96_01855       CDS       T11064                                  Name (GenBank) co-chaperone GroES   KO K04078   chaperonin GroES Organism klx  Klebsiella sp. PCX Brite KEGG Orthology (KO) [BR:klx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:klx03110]     GQR96_01855    03029 Mitochondrial biogenesis [BR:klx03029]     GQR96_01855 Chaperones and folding catalysts [BR:klx03110]  Heat shock proteins   HSP10    GQR96_01855 Mitochondrial biogenesis [BR:klx03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     GQR96_01855 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 DUF7205 Motif Other DBs NCBI-ProteinID:  UKB68020 LinkDB All DBs Position 404134..404427 Genome browser AA seq 97 aa AA seqDB search MSIRPLHDRVIVKRKEVETKSAGGIVLTGSAAAKSTRGEIIAVGKGRILENGTVQPLDVK VGDIVIFNDGYGVKTEKIDNEEVLIMSESDILAIVEA NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgagtattcgtccgttacatgatcgtgtgatcgtcaaacgtaaagaagttgaaaccaaa tctgcgggcggcatcgttctgaccggttctgcagcagctaagtcaacgcgtggcgaaatc atcgctgtcggtaaaggccgcatcctggaaaacgggaccgtgcagccgctggacgttaaa gttggtgacatcgtgattttcaacgatggctacggcgtgaagactgaaaagattgacaac gaagaagtgctgatcatgtccgaaagcgacatcctggcaattgttgaagcttaa

DBGET integrated database retrieval system