Klebsiella sp. PCX: GQR96_09155 Help Entry GQR96_09155       CDS       T11064                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism klx  Klebsiella sp. PCX Pathway klx01100   Metabolic pathways klx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:klx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GQR96_09155 (acpP)    00074 Mycolic acid biosynthesis     GQR96_09155 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GQR96_09155 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  UKB69357 LinkDB All DBs Position 1966099..1966335 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgagcagctgggcgttaagcag gaagaagttaccaacaatgcttccttcgttgaagacctgggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system