Kushneria marisflavi: B9H00_13010 Help Entry B9H00_13010       CDS       T04840                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kma  Kushneria marisflavi Pathway kma01100   Metabolic pathways kma01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kma00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B9H00_13010    00074 Mycolic acid biosynthesis     B9H00_13010   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B9H00_13010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ART64774 UniProt:  A0A240UTG7 LinkDB All DBs Position complement(2847816..2848091) Genome browser AA seq 91 aa AA seqDB search MAKTALTDLERDVANMIIEALELEDITADDIEPEAPLFGDGLGLDSIDALELGLALQKRY GIRLDSDAEENREHFASLRQLSALVAERRCD NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggccaagactgcattgaccgacctcgaacgcgatgtcgccaacatgatcatcgaagcg ctggagcttgaagacattacggctgatgacatcgagcctgaagcgcccctgtttggcgac gggctggggctggattccattgatgcgctggagcttgggctggcgcttcaaaagcgttac ggtatccgcctggacagcgatgccgaggagaaccgcgaacactttgccagcctcagacag ctcagcgctctggtcgccgagcgtcgctgcgactga

DBGET integrated database retrieval system