Kwoniella mangroviensis: 30164913 Help Entry 30164913          CDS       T10313                                  Symbol I203_108206 Name (RefSeq) hypothetical protein   KO K10740   replication factor A3 Organism kmg  Kwoniella mangroviensis Pathway kmg03030   DNA replication kmg03420   Nucleotide excision repair kmg03430   Mismatch repair kmg03440   Homologous recombination kmg03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:kmg00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     30164913 (I203_108206)    03420 Nucleotide excision repair     30164913 (I203_108206)    03430 Mismatch repair     30164913 (I203_108206)    03440 Homologous recombination     30164913 (I203_108206)    03460 Fanconi anemia pathway     30164913 (I203_108206)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:kmg03032]     30164913 (I203_108206)    03400 DNA repair and recombination proteins [BR:kmg03400]     30164913 (I203_108206) DNA replication proteins [BR:kmg03032]  Eukaryotic type   DNA Replication Elongation Factors    RPA (replication protein A)     30164913 (I203_108206) DNA repair and recombination proteins [BR:kmg03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     RPA (replication factor A)      30164913 (I203_108206)    MMR (mismatch excision repair)      30164913 (I203_108206)   DSBR (double strand breaks repair)    HR (homologous recombination)      30164913 (I203_108206) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rep_fac-A_3 Myosin_N MOR2-PAG1_mid Motif Other DBs NCBI-GeneID:  30164913 NCBI-ProteinID:  XP_019002614 LinkDB All DBs Position 3:1055586..1056169 Genome browser AA seq 108 aa AA seqDB search MSPINPEPRINSKYLTQHRGEVVRLTAKVIKLSGDTATVETSDGNTLGVHLSRDMHIGDG FIEIIGTVKDDLSIKAHTYIELGSQLDMKAVNAVVEFAHSGKGQGVLA NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgtctcccatcaacccagagccccgtatcaactccaaataccttactcaacatcgtggt gaggtggtccgtttgactgcgaaagtgatcaagctttccggtgacaccgctaccgttgaa accagtgatgggaacactctcggcgtccatctctcacgagatatgcacatcggtgacgga ttcatagagatcatcggtaccgtcaaggacgacctgagtatcaaagctcatacctatatc gaactagggagtcaactcgatatgaaagccgtcaatgccgtcgtcgaattcgctcacagc ggtaaaggtcaaggtgtgctggcttaa

DBGET integrated database retrieval system