Kwoniella mangroviensis: 30165563 Help Entry 30165563          CDS       T10313                                  Symbol I203_100379 Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism kmg  Kwoniella mangroviensis Pathway kmg04517   IgSF CAM signaling kmg04814   Motor proteins Brite KEGG Orthology (KO) [BR:kmg00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     30165563 (I203_100379)  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     30165563 (I203_100379)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:kmg03037]     30165563 (I203_100379)    04812 Cytoskeleton proteins [BR:kmg04812]     30165563 (I203_100379) Cilium and associated proteins [BR:kmg03037]  Motile cilia and associated proteins   Dynein arm    30165563 (I203_100379) Cytoskeleton proteins [BR:kmg04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      30165563 (I203_100379) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  30165563 NCBI-ProteinID:  XP_019001547 LinkDB All DBs Position 1 Genome browser AA seq 105 aa AA seqDB search MAETKPPSSAGITSLRGQNLNAVIKSVDMSEEMQQKAVDIVVLSLEKHDVERDMAMFIKK EFDRLYGTTWHCVVGKNFGSFVTHETKNFIYFYLGPVAILLWKTS NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggccgagaccaaaccaccttcttctgctgggatcacctcattaagaggtcagaatctc aatgcagtgatcaagagcgtggatatgtccgaagaaatgcaacagaaagcagtcgatatc gtcgttctctcattagagaaacatgatgtagaaagggatatggcaatgtttatcaaaaag gaatttgataggttgtatggaaccacatggcattgcgtagtgggtaagaatttcggcagt ttcgtaactcacgaaaccaagaatttcatctacttctacctcggtccagtcgctatactc ttatggaagacttcataa

DBGET integrated database retrieval system