Klebsiella michiganensis RC10: VW41_08170 Help Entry VW41_08170        CDS       T03782                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kmi  Klebsiella michiganensis RC10 Pathway kmi01100   Metabolic pathways kmi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kmi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     VW41_08170    00074 Mycolic acid biosynthesis     VW41_08170   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     VW41_08170 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 HLH TerB Motif Other DBs NCBI-ProteinID:  AJZ89007 LinkDB All DBs Position 1727109..1727345 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVVNTASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcattggcgaacaactgggcgttaagcaa gaagaagtagtgaacaccgcttccttcgttgaggacctcggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system