Klebsiella michiganensis RC10: VW41_12685 Help Entry VW41_12685        CDS       T03782                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism kmi  Klebsiella michiganensis RC10 Pathway kmi00362   Benzoate degradation kmi01100   Metabolic pathways kmi01120   Microbial metabolism in diverse environments kmi01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:kmi00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     VW41_12685    00622 Xylene degradation     VW41_12685    00621 Dioxin degradation     VW41_12685 Enzymes [BR:kmi01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      VW41_12685 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Tautomerase_3 Motif Other DBs NCBI-ProteinID:  AJZ89825 LinkDB All DBs Position complement(2729971..2730180) Genome browser AA seq 69 aa AA seqDB search MPYVNIRVTREGVSAEQKLALIEGVTDLLEQVLNKKPADTFVVIDEVETDNWGVNRESVT GRRRREAGQ NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgccatacgttaatattcgcgtcacccgggaaggggtcagcgcagagcagaagcttgcg ctgattgagggcgtcaccgacctgctggagcaggtgttaaacaaaaagcccgccgacacc tttgtggttatcgatgaggttgaaaccgacaactggggcgtgaaccgcgaaagcgtgacc ggccggcggcggcgtgaagccgggcagtag

DBGET integrated database retrieval system