Kaustia mangrovi: HW532_19510 Help Entry HW532_19510       CDS       T07196                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kmn  Kaustia mangrovi Pathway kmn01100   Metabolic pathways kmn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kmn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HW532_19510    00074 Mycolic acid biosynthesis     HW532_19510   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HW532_19510 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  QPC44696 UniProt:  A0A7S8C789 LinkDB All DBs Position 4122344..4122580 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVVEHLGVEADKVSEDASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTVGDAVKFIEKNSG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgatattgctgaacgggtgaagaagatcgtggtcgagcacctcggtgtcgaggcc gacaaggtttccgaggacgcgagcttcatcgacgacctcggcgcggacagcctcgacacc gtcgagctggtcatggcgttcgaggaggagttcggcatcgagattccggacgacgcggcc gaaaccatccagactgtcggcgacgccgtgaagttcatcgagaagaattccggctga

DBGET integrated database retrieval system