KEGG Orthology (KO) [BR:kmr00001]
09180 Brite Hierarchies
09181 Protein families: metabolism
01009 Protein phosphatases and associated proteins [BR:kmr01009]
108241757 (grxcr1b)
09182 Protein families: genetic information processing
03110 Chaperones and folding catalysts [BR:kmr03110]
108241757 (grxcr1b)
09183 Protein families: signaling and cellular processes
03037 Cilium and associated proteins [BR:kmr03037]
108241757 (grxcr1b)
Protein phosphatases and associated proteins [BR:kmr01009]
Protein serine/threonine phosphatases
Phosphoprotein phosphatases (PPPs)
Protein phosphatase-1
PP1-interacting proteins (PIPs)
108241757 (grxcr1b)
Chaperones and folding catalysts [BR:kmr03110]
Protein folding catalysts
Protein disulfide isomerase
108241757 (grxcr1b)
Cilium and associated proteins [BR:kmr03037]
Other cilia and associated proteins
Stereociliary proteins
108241757 (grxcr1b)
149 aa
MEGPKPKQEKEKAGKTVRFRVASANSGRVLAEVFKDERTWCGSVSESVDSDGTGSSEAEQ
VSSLPASEANRHLNGLQAHADGGEPDDLLLYASVKRDMLFSNKRINICSKNGTIRGVRNK
VSAGQVLFNNLSNMYSGSHRQRRWPWEKE