Kluyveromyces marxianus: KLMA_40475 Help Entry KLMA_40475        CDS       T05269                                  Symbol RPO26 Name (RefSeq) DNA-directed RNA polymerases I   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism kmx  Kluyveromyces marxianus Pathway kmx03020   RNA polymerase kmx03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:kmx00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     KLMA_40475 (RPO26)   09124 Replication and repair    03420 Nucleotide excision repair     KLMA_40475 (RPO26)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:kmx03021]     KLMA_40475 (RPO26)    03400 DNA repair and recombination proteins [BR:kmx03400]     KLMA_40475 (RPO26) Transcription machinery [BR:kmx03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      KLMA_40475 (RPO26)   RNA polymerase III system    RNA polymerase III      KLMA_40475 (RPO26)   RNA polymerase I system    RNA polymerase I      KLMA_40475 (RPO26) DNA repair and recombination proteins [BR:kmx03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       KLMA_40475 (RPO26) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb6 DUF7301 Motif Other DBs NCBI-GeneID:  34716461 NCBI-ProteinID:  XP_022676320 UniProt:  W0TEG8 LinkDB All DBs Position 4:1076966..1077442 Genome browser AA seq 158 aa AA seqDB search MSDNEEAFNDGPENYEDFDQEHFSDYEGFDESEGKFGAGNGLGTDENGNTIVAGGFGPEE FQQQEARRKRTLKEKAIPKEERTTTPYMTKYERARILGTRALQISMNAPVFVDLEGETDP LRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL NT seq 477 nt NT seq  +upstreamnt  +downstreamnt atgtctgataacgaggaagcctttaacgatggtccagaaaactacgaagatttcgaccaa gaacacttttcagactatgaagggtttgatgaatcagaaggtaaatttggtgctggtaac ggattaggcactgatgaaaatggtaatacaattgttgctggtggatttggtccagaggaa ttccagcaacaagaggcacgtagaaagagaactttgaaggaaaaggctattcctaaagag gagcgtaccacaacgccgtatatgactaaatatgagagggctagaatcctcgggactaga gcattgcaaatatctatgaatgcgccagtgtttgtggatttggagggggaaacggatcca ttgagaatagcaatgaaagagttggctgagaagaagatcccattggttatcagaagatac cttcctgatggttctttcgaggactggtcagttgaggagctcattgtggacttgtaa

DBGET integrated database retrieval system