KEGG   Kluyveromyces marxianus: KLMA_50027
Entry
KLMA_50027        CDS       T05269                                 
Symbol
SLK19
Name
(RefSeq) kinetochore protein SLK19
  KO
K12575  kinetochore protein SLK19
Organism
kmx  Kluyveromyces marxianus
Pathway
kmx04111  Cell cycle - yeast
kmx04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:kmx00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    KLMA_50027 (SLK19)
   04113 Meiosis - yeast
    KLMA_50027 (SLK19)
SSDB
Motif
Pfam: Fungal_TACC YabA HIP1_clath_bdg TPR_MLP1_2 PKcGMP_CC Fez1 Golgin_A5 Tropomyosin_1 ATG16 Crescentin
Other DBs
NCBI-GeneID: 34716644
NCBI-ProteinID: XP_022676501
LinkDB
Position
5:57687..59600
AA seq 637 aa
MDSMPAELGNKPKLSFEGHENQLEQPIRLLADESNKENVHSLESDGENIDRNQPLYKRAR
MEYSSPEKIEMLNSLSPIKLYTEGEDIADTDAKRNVAVELEEAMKSLQKEDNEEEEEEEA
FAKLENSYNRSSAIRSPSQSDKHTNSKETDSAFHETMSPILVKRQEELYDNTRSNDEWEA
KFENLFEEIHKKSEDIRQLTAQTAVLKDKLIREERIVQEQKLHLIKQERECSNLKEQLRS
FHSLETEHENISKKFEACKQKLKEVKIELSMTNQNNQILSEKFEKEYAKFAENENLVNEW
KDKYNSVSSELHASANKLTTLKKELQLKEEEFNNKVKQLDDLQIEIADLKNNNDQEKNEL
KQKLSDKDQILNEMEEKLKYFESKDSDEISSLKQDLEKAQADLCDKNEQIKDLEYSLTTK
EAHVQQLNSQVDELSKEKDSVLLDLENTRRDLDSLAGKTANIESEQLAELETLHQNMSQM
EKSLKENVSTISSLTAEIREMESKCKSLELENNDLKKRLKANEDITKEKSTDTESSKVKE
LMEKIAQMEKTIAASETETNKKLQLLAEDLYIQYSSKHEQKVKMLKKGYETRYQDLIDKL
TIENNALHDEVGQLQKTVETERAEKQELIKSLDAQNE
NT seq 1914 nt   +upstreamnt  +downstreamnt
atggattcaatgccggcagaactggggaataaacctaaattgtcctttgaagggcatgaa
aaccaactagagcaacccattcgattattggcggatgaaagtaacaaagaaaacgtgcat
tctctggaaagcgatggtgaaaatatcgataggaaccaacctttatataagcgggccagg
atggaatattcttctccggagaagatagaaatgctcaacagtttgtctcctataaagctt
tatacagaaggggaagatattgcggatacagatgcaaagagaaacgttgcagtcgaattg
gaggaggctatgaagagcttacaaaaagaggacaatgaggaggaagaagaagaagaagca
tttgccaaactcgagaatagttataacaggtcttctgcgataagatcaccatctcaatca
gataaacatactaattcaaaggaaacagatagtgctttccatgaaactatgtcaccaatc
ctggtgaagagacaagaggaattatatgataatacacgttctaatgacgagtgggaggct
aaattcgagaacttgtttgaagagatccacaaaaagagtgaagatataaggcaattaact
gcacagactgctgtgttgaaggataaacttatacgagaagaacgtatagttcaagagcag
aagttacatctcataaaacaagaaagagaatgctcgaatttaaaggagcagctacgttct
tttcacagcttagaaacagagcatgaaaatataagcaaaaaatttgaagcctgcaaacaa
aagcttaaagaagtcaagatagaactttctatgacgaaccagaacaaccaaattctaagc
gaaaaattcgagaaagaatatgctaagtttgctgaaaatgaaaatcttgtaaatgagtgg
aaagacaagtataactccgtttccagcgaacttcatgctagtgccaataaactaactacc
ttaaagaaagaactacagctaaaggaagaagaatttaataacaaagtcaaacaactagat
gacctccaaatagaaatagcggacttgaagaataataatgatcaggaaaagaatgagttg
aaacaaaagttaagtgataaagatcaaattctgaatgagatggaagaaaaactaaagtat
tttgaaagcaaagattccgatgaaatttcctcattgaagcaagatctcgaaaaagcccaa
gctgacctttgtgataagaatgaacaaataaaggatctagaatattcattaacaactaaa
gaggctcatgtacagcaattaaacagccaagtcgatgaattgtcgaaggaaaaagattct
gtgttgcttgatctcgaaaatacgaggagagatttagactctttggccgggaaaacagct
aatatcgagtccgaacaacttgcagaactggaaacactccatcagaacatgtctcaaatg
gaaaaaagcctgaaagagaacgtttctaccattagtagtctaacggcagagatcagagag
atggaaagcaaatgtaaatcactagaattggagaataatgatttaaaaaagcgtttgaaa
gcaaacgaagatatcacaaaggaaaaatctacagatacagaatcatctaaggttaaagaa
ctaatggaaaagattgcgcagatggagaaaactattgcggcatctgaaacagaaacaaac
aagaaacttcagttattggcagaagatctatatattcaatactcttccaaacacgaacag
aaagttaaaatgttaaagaaaggctatgaaactagatatcaagatttgatagacaagctt
actatcgagaacaatgcattgcacgatgaagttgggcaactacaaaaaactgtggagact
gagcgagctgaaaaacaagagttgatcaaatcattagatgcccagaatgagtaa

DBGET integrated database retrieval system