Kluyveromyces marxianus: KLMA_50127 Help Entry KLMA_50127        CDS       T05269                                  Symbol CDC42 Name (RefSeq) cell division control protein 42   KO K04393   cell division control protein 42 Organism kmx  Kluyveromyces marxianus Pathway kmx04011   MAPK signaling pathway - yeast kmx04144   Endocytosis kmx05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:kmx00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     KLMA_50127 (CDC42)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     KLMA_50127 (CDC42)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     KLMA_50127 (CDC42)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:kmx04131]     KLMA_50127 (CDC42)    03036 Chromosome and associated proteins [BR:kmx03036]     KLMA_50127 (CDC42)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:kmx04147]     KLMA_50127 (CDC42)    04031 GTP-binding proteins [BR:kmx04031]     KLMA_50127 (CDC42) Membrane trafficking [BR:kmx04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     KLMA_50127 (CDC42)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     KLMA_50127 (CDC42)   Macropinocytosis    Ras GTPases     KLMA_50127 (CDC42) Chromosome and associated proteins [BR:kmx03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     KLMA_50127 (CDC42) Exosome [BR:kmx04147]  Exosomal proteins   Exosomal proteins of microglial cells    KLMA_50127 (CDC42)   Exosomal proteins of breast milk    KLMA_50127 (CDC42) GTP-binding proteins [BR:kmx04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     KLMA_50127 (CDC42) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  34716742 NCBI-ProteinID:  XP_022676599 LinkDB All DBs Position 5:complement(275483..276058) Genome browser AA seq 191 aa AA seqDB search MQTLKCVVIGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVMIGDEPYTLGLFDTAG QEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLIVGTQIDLR DDKVIIEKLQRQRLRPITPEQGERLARELRAVKYVECSALTQRGLKNVFDEAIVAALEPP VIKKSKKCTIL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcaaactctaaagtgtgttgttataggtgatggtgctgttgggaaaacgtgtcttcta atctcatacaccaccaaccagttcccagcagattacgttccaactgtttttgataactat gctgtcacagtaatgattggggatgagccatatactctaggtctttttgatactgctggt caagaagattatgatagattgaggccgttatcgtatccatcaacggacgtgttcttggtt tgtttcagcgttatatctccaccttcttttgagaacgtaaaagagaagtggttcccagag gtacatcaccactgtcctggtgtcccctgtttgattgtgggtactcagatagatttaaga gacgacaaagtcattattgaaaaattacaaagacaaagacttcgtcctattactccagag caaggtgagagactagcaagagaactaagggctgtgaaatatgttgagtgttccgctctt actcaacgtggtttgaagaacgttttcgatgaggctattgtcgctgctttggaaccaccg gtcatcaaaaagagtaaaaaatgtactatattgtaa

DBGET integrated database retrieval system