Kluyveromyces marxianus: KLMA_60100 Help Entry KLMA_60100        CDS       T05269                                  Name (RefSeq) hypothetical protein   KO K12416   anaphase-promoting complex subunit SWM1 Organism kmx  Kluyveromyces marxianus Pathway kmx04111   Cell cycle - yeast kmx04113   Meiosis - yeast kmx04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:kmx00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     KLMA_60100  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     KLMA_60100    04113 Meiosis - yeast     KLMA_60100  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:kmx04121]     KLMA_60100    03036 Chromosome and associated proteins [BR:kmx03036]     KLMA_60100 Ubiquitin system [BR:kmx04121]  Ubiquitin ligases (E3)   Multi subunit type E3    APC/C     Other subunits      KLMA_60100 Chromosome and associated proteins [BR:kmx03036]  Eukaryotic type   Sister chromatid separation proteins    APC/C complex     KLMA_60100 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  34717327 NCBI-ProteinID:  XP_022677184 UniProt:  W0TF19 LinkDB All DBs Position 6:222475..222807 Genome browser AA seq 110 aa AA seqDB search MNYLDSQTRHYHYARAQHMCWNWNDPTNEDGNRFPLPDQESVRQDAHAGLQVNVGEPNSY WDCYVDEDQWQVFQDLLMDCNGNLTRNDESEGNLFRHVIKARDLKLPLPL NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atgaactatttggactcacagacaagacactaccactacgcaagggcccagcacatgtgc tggaactggaacgaccccacaaacgaagatggaaaccggtttcccttgcccgaccaggaa agcgtacggcaggacgcgcatgccgggttgcaggtgaacgtgggcgagcccaacagctac tgggactgctacgtggacgaggaccagtggcaggtgttccaggacttgttgatggactgc aacgggaacctaacgagaaacgacgaatccgagggcaaccttttcaggcacgtgatcaaa gcacgtgatctcaaattacccttacccttgtga

DBGET integrated database retrieval system