Kluyveromyces marxianus: KLMA_60198 Help Entry KLMA_60198        CDS       T05269                                  Name (RefSeq) protein transport protein SSS1   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism kmx  Kluyveromyces marxianus Pathway kmx03060   Protein export kmx04141   Protein processing in endoplasmic reticulum kmx04145   Phagosome Brite KEGG Orthology (KO) [BR:kmx00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     KLMA_60198    04141 Protein processing in endoplasmic reticulum     KLMA_60198  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     KLMA_60198  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:kmx04131]     KLMA_60198   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:kmx02044]     KLMA_60198 Membrane trafficking [BR:kmx04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     KLMA_60198 Secretion system [BR:kmx02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    KLMA_60198 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecE Spectrin_7 Motif Other DBs NCBI-GeneID:  34717423 NCBI-ProteinID:  XP_022677280 UniProt:  W0THA2 LinkDB All DBs Position 6:422793..423005 Genome browser AA seq 70 aa AA seqDB search MAKQNAQFEKLVEAPLEFVKDGNQFLQKCKKPTKKEYLKIVQAVGIGFVAVGVIGYAIKL IHIPIRYLIV NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atggccaagcaaaacgcgcaattcgaaaagctagtggaagctccattggagtttgtgaag gatgggaaccagttcttgcaaaagtgcaagaagcctacgaagaaggagtacttgaagatt gtgcaagcagttgggattggttttgttgccgttggtgtgattgggtatgcgatcaagttg atccacattccaatcagatacttgattgtgtga

DBGET integrated database retrieval system