Kluyveromyces marxianus: KLMA_60400 Help Entry KLMA_60400        CDS       T05269                                  Symbol SGF11 Name (RefSeq) SAGA-associated factor 11   KO K11363   SAGA-associated factor 11 Organism kmx  Kluyveromyces marxianus Brite KEGG Orthology (KO) [BR:kmx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:kmx03021]     KLMA_60400 (SGF11)    03036 Chromosome and associated proteins [BR:kmx03036]     KLMA_60400 (SGF11) Transcription machinery [BR:kmx03021]  Eukaryotic type   RNA polymerase II system    Coactivators     SAGA/TFTC/STAGA complex      KLMA_60400 (SGF11) Chromosome and associated proteins [BR:kmx03036]  Eukaryotic type   Histone modification proteins    HAT complexes     SAGA complex      KLMA_60400 (SGF11)     SLIK complex      KLMA_60400 (SGF11) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sgf11_N Sgf11 DUF8118 CpG_bind_C zf-BED Motif Other DBs NCBI-GeneID:  34717615 NCBI-ProteinID:  XP_022677472 UniProt:  W0TFU5 LinkDB All DBs Position 6:complement(834711..835004) Genome browser AA seq 97 aa AA seqDB search MTASLTTDSVANSIYHNLITSIIQDIVSRQTVKQKLIKQQFPDAKPYHYDPSGTYDIHGK PKQADSAVYIECNVCGREVSGNRFAAHLVRCLSRGKR NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaccgcatcattgaccacagactcagtagccaattcgatataccacaaccttatcacc tcaattattcaagatattgtttctcgccaaacggtcaagcagaaacttatcaagcagcag ttccccgatgcaaagccctaccattacgatccatcaggcacatacgatattcatggcaag cccaaacaagcggactcggccgtgtatattgagtgcaacgtctgcggccgtgaggtgagt gggaataggtttgcagcgcatctcgtaagatgtttgtcacgtggtaagagatag

DBGET integrated database retrieval system