Kluyveromyces marxianus: KLMA_70194 Help Entry KLMA_70194        CDS       T05269                                  Symbol HUB1 Name (RefSeq) ubiquitin-like modifier HUB1   KO K13113   ubiquitin-like protein 5 Organism kmx  Kluyveromyces marxianus Brite KEGG Orthology (KO) [BR:kmx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:kmx03041]     KLMA_70194 (HUB1)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:kmx04052]     KLMA_70194 (HUB1) Spliceosome [BR:kmx03041]  Complex B   Other components    Complex B specific factors     KLMA_70194 (HUB1) Cytokines and neuropeptides [BR:kmx04052]  Neuropeptides   Unclassified    KLMA_70194 (HUB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 YukD Motif Other DBs NCBI-GeneID:  34717951 NCBI-ProteinID:  XP_022677807 UniProt:  W0TEH5 LinkDB All DBs Position 7:399999..400223 Genome browser AA seq 74 aa AA seqDB search MIEVLVNDRLGKKVCVKCLEEDTIGEFKQVLSVQLGTASAAKIVLQKGGSVLKDHITLED YEIHDGTNLELYYV NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgatagaggttttagtaaacgatcgacttggtaagaaagtgtgtgtgaaatgccttgag gaagacactattggtgagtttaaacaagtgttgagtgttcaacttgggactgcgagtgct gccaagatcgtgttgcaaaaaggtggtagtgtattgaaggatcacattactctggaggat tacgaaattcatgacggaactaacctcgagttgtactatgtgtaa

DBGET integrated database retrieval system