Kluyveromyces marxianus: KLMA_70268 Help Entry KLMA_70268        CDS       T05269                                  Symbol RHO1 Name (RefSeq) GTP-binding protein Rho1   KO K04513   Ras homolog gene family, member A Organism kmx  Kluyveromyces marxianus Pathway kmx04011   MAPK signaling pathway - yeast kmx04081   Hormone signaling kmx04144   Endocytosis kmx05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:kmx00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     KLMA_70268 (RHO1)   09133 Signaling molecules and interaction    04081 Hormone signaling     KLMA_70268 (RHO1)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     KLMA_70268 (RHO1)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     KLMA_70268 (RHO1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:kmx04131]     KLMA_70268 (RHO1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:kmx04147]     KLMA_70268 (RHO1)    04031 GTP-binding proteins [BR:kmx04031]     KLMA_70268 (RHO1) Membrane trafficking [BR:kmx04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     KLMA_70268 (RHO1) Exosome [BR:kmx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    KLMA_70268 (RHO1)   Exosomal proteins of other body fluids (saliva and urine)    KLMA_70268 (RHO1)   Exosomal proteins of colorectal cancer cells    KLMA_70268 (RHO1)   Exosomal proteins of bladder cancer cells    KLMA_70268 (RHO1) GTP-binding proteins [BR:kmx04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     KLMA_70268 (RHO1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  34718023 NCBI-ProteinID:  XP_022677879 LinkDB All DBs Position 7:571877..572503 Genome browser AA seq 208 aa AA seqDB search MSQAVSNVASIRRKLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYVADVEVDGRRV ELALWDTAGQEDYDRLRPLSYPDSNVVLICYSIDLPDSLENVMEKWISEVLHFCQGVPII LVGCKADLRNDPQVVEELRAQGLEPVSQAQAQEVADQIGAVDYIECSAKTGYGVREVFEA ATRASLVGKQGKSKPKTKSSKKKKCTVL NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atgtctcaagctgtgagtaatgttgctagcattagaaggaagctagttattgttggtgat ggtgcgtgtggtaaaacatgtttgttgattgtttttgcaaaggggaagtttcctcaggtt tatgtgcccactgttttcgacaactacgttgccgatgtggaggtagatggacgtcgtgtt gagttggcgttatgggatactgctgggcaagaagattacgatagattgagaccactttcg tatccagactctaacgttgtgttgatttgttactcgatcgacttgccagattctttggag aatgtgatggaaaagtggatctctgaggttttgcatttctgtcaaggtgtgccaatcatc ttggttgggtgcaaggctgatttgcgtaacgatcctcaagtcgttgaggagctaagagca caaggtttggagcctgtttcgcaagcgcaagcgcaagaagtggctgaccaaatcggtgcc gtcgactacatcgaatgttccgctaaaaccggctacggtgtcagagaggtcttcgaggcc gctaccagagcctccttggtcgggaaacagggcaagagcaagccaaagaccaagtctagc aaaaagaagaagtgtactgttttgtaa

DBGET integrated database retrieval system