Kluyveromyces marxianus: KLMA_80039 Help Entry KLMA_80039        CDS       T05269                                  Symbol YPT7 Name (RefSeq) GTP-binding protein YPT7   KO K07897   Ras-related protein Rab-7A Organism kmx  Kluyveromyces marxianus Pathway kmx04138   Autophagy - yeast kmx04144   Endocytosis kmx04145   Phagosome kmx04148   Efferocytosis Brite KEGG Orthology (KO) [BR:kmx00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     KLMA_80039 (YPT7)    04145 Phagosome     KLMA_80039 (YPT7)    04138 Autophagy - yeast     KLMA_80039 (YPT7)    04148 Efferocytosis     KLMA_80039 (YPT7)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:kmx04131]     KLMA_80039 (YPT7)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:kmx04147]     KLMA_80039 (YPT7)    04031 GTP-binding proteins [BR:kmx04031]     KLMA_80039 (YPT7) Membrane trafficking [BR:kmx04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     KLMA_80039 (YPT7) Exosome [BR:kmx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    KLMA_80039 (YPT7)   Exosomal proteins of other body fluids (saliva and urine)    KLMA_80039 (YPT7)   Exosomal proteins of colorectal cancer cells    KLMA_80039 (YPT7)   Exosomal proteins of bladder cancer cells    KLMA_80039 (YPT7) GTP-binding proteins [BR:kmx04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     KLMA_80039 (YPT7) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase ATP_bind_1 SRPRB nSTAND3 AAA_16 AAA_22 PduV-EutP NTPase_1 cobW NACHT AAA_7 AAA_33 AAA_24 nSTAND1 TniB AAA_5 Septin UBA_Rad5 ATPase_2 Motif Other DBs NCBI-GeneID:  34718240 NCBI-ProteinID:  XP_022678097 UniProt:  W0TG78 LinkDB All DBs Position 8:114988..115611 Genome browser AA seq 207 aa AA seqDB search MSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQ VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFDNIKSWRDEFLVHANVSSPETFPF VILANKVDVEESKKVVSSRSAQELAKSLGNVPLFFTSAKDAINVQDAFEEIARSALQQSQ SDADAYEDDLNEAINIQLDGEPSSCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgtctagaaagaagaatattctcaaggtgatcattctaggtgattctggtgtcgggaaa acctctttgatgcaccgttatgtgaatgataagtactcccaacaatacaaagcgacgata ggtgccgattttcttaccaaggaagtgattgtgaacgatgataaggttgcaacgatgcaa gtatgggacactgctggacaggagagattccaatcgctcggagtagccttttataggggt gctgattgttgtgtattggtatacgatgtcacgaacgcaaagtcttttgacaacatcaag tcctggagggacgagtttttggtccatgccaatgtttcctcgccagaaactttccccttt gtgattttagccaacaaggtggacgtagaagagtccaaaaaagtggtttcatcgagatct gctcaagagttggcaaagtcgttgggcaacgtgcccttgttcttcactagtgcaaaggac gctatcaacgtccaagatgcatttgaggaaattgctcgcagcgcattacagcaaagtcaa tcagatgcagatgcatacgaagacgatttgaatgaagcaatcaacatccaattggatgga gaaccaagctcatgtagctgctga

DBGET integrated database retrieval system