Komagataeibacter nataicola: B0W47_14325
Help
Entry
B0W47_14325 CDS
T04737
Name
(GenBank) energy transducer TonB
KO
K03832
periplasmic protein TonB
Organism
kna
Komagataeibacter nataicola
Brite
KEGG Orthology (KO) [BR:
kna00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
kna02000
]
B0W47_14325
Transporters [BR:
kna02000
]
Other transporters
Electrochemical potential-driven transporters [TC:
2
]
B0W47_14325
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
TonB_C
TonB_2
Motif
Other DBs
NCBI-ProteinID:
AQU88435
UniProt:
A0A9N7CWB6
LinkDB
All DBs
Position
2981358..2982206
Genome browser
AA seq
282 aa
AA seq
DB search
MPSVFSRHAAVSSFTLWHAASLRRADRRDGLLWGASLLVVVGGLAGAAWWVMRQPPPVMP
VPEAPPAAIAIDLAPEPVATPAPPTDAPPGPMQVLSQPDPTPQPPPEITAPPSPAPNPPV
AVPREEDRKTPPKKKRPLPPVKDAPPDRKPPAAATTAPPGLVAPPAATQAAPMPEGDPAH
ATHAMPSWQAALLARLEHYKRYPAQAQAGRQEGVALLHFAMDRQGHVLSARIGHSAGHAL
LDEETLALLRRADPLPVPPPEVRGDPVVLSVPVEFHLDEERR
NT seq
849 nt
NT seq
+upstream
nt +downstream
nt
atgccctccgttttctcacgccatgctgcggtcagttcctttacgctatggcacgccgcc
agcctgcggcgtgctgaccggcgcgatgggctgctatggggcgcgtcattgctggtggtt
gtgggcgggctggcgggtgcggcatggtgggtgatgcgccagccgccgccggtcatgccc
gtgccggaagccccgcccgcagccattgccatcgatctggcacccgaaccggtagccacc
cccgcgcccccgactgatgcgccacccggccccatgcaggtactctcgcagcctgacccc
acgccgcagcctccccccgaaatcaccgctccgccgtcgcccgcgcccaacccgcccgtt
gcggtgccacgggaggaagaccgcaaaaccccgccgaaaaagaagcggcccctgccgccc
gtcaaggacgcgccacctgaccgcaagccccctgccgcggcaacaacggcaccgccaggc
cttgtcgcaccccctgccgccacgcaggccgcccccatgccggagggtgatccggctcac
gccacgcatgccatgcccagctggcaggcagcactgctcgcacggctggaacattacaag
cgctaccccgcgcaggcgcaggccgggcggcaggaaggcgttgcgttgctgcattttgca
atggaccggcaggggcatgtcctttcggcccgcatcgggcatagcgcaggccatgcgctg
ctcgatgaggaaacgcttgccctgctcaggcgggcggaccccctgccggttcccccgccc
gaggtcaggggagatccggtcgtgctgagcgtgccggtggaattccatctggatgaggaa
cggcgctag
DBGET
integrated database retrieval system