Komagataeibacter nataicola: B0W47_14855 Help Entry B0W47_14855       CDS       T04737                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kna  Komagataeibacter nataicola Pathway kna01100   Metabolic pathways kna01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kna00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B0W47_14855    00074 Mycolic acid biosynthesis     B0W47_14855   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B0W47_14855 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1493 DUF5783 Motif Other DBs NCBI-ProteinID:  AQU88526 UniProt:  A0A9N7CAP2 LinkDB All DBs Position 3102442..3102681 Genome browser AA seq 79 aa AA seqDB search MSEIADKVKKIVVEHLGVDESKVTPDASFIDDLGADSLDTVELVMAFEEAFSVEIPEDAA EKITTVKDAIDYIEKQKAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgaaatcgccgataaggttaagaagatcgtagtcgagcaccttggtgttgacgaa agcaaggtcaccccggatgcctctttcatcgacgatctgggcgccgacagcctcgacacg gtcgagctggtcatggcgttcgaggaagcgttcagcgtcgagatccccgaggatgcggct gaaaagatcacgaccgtgaaggacgcgatcgactacatcgaaaagcagaaagctgcctga

DBGET integrated database retrieval system