Kitasatospora hibisci: ACF9IK_05495 Help Entry ACF9IK_05495      CDS       T11051                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism knb  Kitasatospora hibisci Pathway knb00998   Biosynthesis of various antibiotics knb01100   Metabolic pathways knb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:knb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ACF9IK_05495    00074 Mycolic acid biosynthesis     ACF9IK_05495   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ACF9IK_05495 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  XIJ52326 LinkDB All DBs Position complement(1288861..1289109) Genome browser AA seq 82 aa AA seqDB search MSLIRSMLVELTGTSEYTDAIGDDADLAASGIDSGDLVRLVLLIEQRTGVEVTAEDMEKL ATIGDYERFVEERSAALQSGGA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgagcctgatcaggtcgatgctggtggaactgaccggcacctcggagtacaccgacgcg atcggtgacgacgccgacctcgcagccagcggcatcgacagcggggacctggtgcgcctg gtcctgctcatcgagcagcgcaccggcgtggaggtcaccgccgaggacatggagaagctc gccacgatcggtgactacgagcgcttcgtcgaggagcggagcgccgccctgcagtccggc ggcgcgtga

DBGET integrated database retrieval system