Kwoniella newhampshirensis: 92180345 Help Entry 92180345          CDS       T10314                                  Symbol IAR55_003087 Name (RefSeq) hypothetical protein   KO K10881   26 proteasome complex subunit DSS1 Organism kne  Kwoniella newhampshirensis Pathway kne03050   Proteasome kne03440   Homologous recombination Brite KEGG Orthology (KO) [BR:kne00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     92180345 (IAR55_003087)   09124 Replication and repair    03440 Homologous recombination     92180345 (IAR55_003087)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:kne03019]     92180345 (IAR55_003087)    04131 Membrane trafficking [BR:kne04131]     92180345 (IAR55_003087)    03051 Proteasome [BR:kne03051]     92180345 (IAR55_003087)    03400 DNA repair and recombination proteins [BR:kne03400]     92180345 (IAR55_003087) Messenger RNA biogenesis [BR:kne03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      92180345 (IAR55_003087) Membrane trafficking [BR:kne04131]  Exocytosis   Tethering complex    Exocyst complex assembly proteins     92180345 (IAR55_003087) Proteasome [BR:kne03051]  Eukaryotic proteasome   Regulatory particles    PA700 (19S proteasome)     non-ATPase subunits      92180345 (IAR55_003087) DNA repair and recombination proteins [BR:kne03400]  Eukaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     Other HR factors      92180345 (IAR55_003087) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DSS1_SEM1 Rhamno_transf Motif Other DBs NCBI-GeneID:  92180345 NCBI-ProteinID:  XP_066803698 UniProt:  A0AAW0Z0H3 LinkDB All DBs Position 5:1431565..1432273 Genome browser AA seq 107 aa AA seqDB search MAEKATDNNATAGPSNGSTSATTTAPPAEKKALPKLGALEDDDEFEDFPATDYGGNIQDA LKKAGAGPNDNLWEDNWDDDDVEDDFTKQLRTAIQERSGAQDETMKE NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggcagagaaagcgacagataacaacgcgacagccggtccgtccaacggtagcacgagc gccaccaccacagcacctcctgctgagaagaaggctctgcccaagctcggtgcgttggaa gatgatgatgagttcgaggatttccctgctaccgactacggtggcaacattcaagacgca ttgaagaaggcaggtgcgggaccgaacgataatctctgggaagataactgggatgacgat gatgttgaagatgatttcacaaagcaattgagaaccgccattcaagaacgatcgggcgct caggacgagacgatgaaggagtag

DBGET integrated database retrieval system