Huiozyma naganishii: KNAG_0C03200 Help Entry KNAG_0C03200      CDS       T08174                                  Symbol KNAG0C03200 Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism kng  Huiozyma naganishii Pathway kng04814   Motor proteins Brite KEGG Orthology (KO) [BR:kng00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     KNAG_0C03200 (KNAG0C03200)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:kng03037]     KNAG_0C03200 (KNAG0C03200)    04812 Cytoskeleton proteins [BR:kng04812]     KNAG_0C03200 (KNAG0C03200) Cilium and associated proteins [BR:kng03037]  Motile cilia and associated proteins   Dynein arm    KNAG_0C03200 (KNAG0C03200) Cytoskeleton proteins [BR:kng04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      KNAG_0C03200 (KNAG0C03200) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light DUF3646 Ground-like Motif Other DBs NCBI-GeneID:  34525110 NCBI-ProteinID:  XP_022463676 UniProt:  J7R3M2 LinkDB All DBs Position 3:630592..631068 Genome browser AA seq 94 aa AA seqDB search MSAHGAGEIPEPILKASDISDEMRDAVYEQTRLAMAEHTVERDIASTLKKALDAEFGGPW HVVVGKNFGSYVTHEKAHFLYFYIGPLAFLVFKT NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgtcagcacatggtgcaggagagatcccagaacctatcctcaaggcatcagacatttcc gatgagatgagagacgcggtgtacgaacagacaagacttgcgatggcggagcacacagtg gagagagacattgcgagcacgctgaagaaggcacttgacgcggagtttggcggaccttgg cacgtcgttgttgggaagaacttcgggtcgtacgtcacgcacgagaaggcgcacttcttg tacttctacatcggaccgctcgccttcctcgtcttcaagacctga

DBGET integrated database retrieval system