Huiozyma naganishii: KNAG_0F01010 Help Entry KNAG_0F01010      CDS       T08174                                  Symbol KNAG0F01010 Name (RefSeq) hypothetical protein   KO K00730   dolichyl-diphosphooligosaccharide---protein glycosyltransferase subunit 4 Organism kng  Huiozyma naganishii Pathway kng00510   N-Glycan biosynthesis kng00513   Various types of N-glycan biosynthesis kng01100   Metabolic pathways kng04141   Protein processing in endoplasmic reticulum Module kng_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:kng00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     KNAG_0F01010 (KNAG0F01010)    00513 Various types of N-glycan biosynthesis     KNAG_0F01010 (KNAG0F01010)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     KNAG_0F01010 (KNAG0F01010) SSDB OrthologParalogGFIT Motif Pfam:  Ost4 SK_channel Motif Other DBs NCBI-GeneID:  34526485 NCBI-ProteinID:  XP_022465016 LinkDB All DBs Position 6:<183212..>183322 Genome browser AA seq 36 aa AA seqDB search MINDAQLNSLVIFSGLVMVTLIVIYHAIGSTFDKLK NT seq 111 nt NT seq  +upstreamnt  +downstreamnt atgattaacgacgcccaactgaactcgctggtcattttctcaggacttgtcatggttacg ctgattgtgatatatcatgccattggttcgacgttcgataaattgaagtaa

DBGET integrated database retrieval system