Huiozyma naganishii: KNAG_0H02920 Help Entry KNAG_0H02920      CDS       T08174                                  Symbol KNAG0H02920 Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism kng  Huiozyma naganishii Pathway kng03060   Protein export kng04141   Protein processing in endoplasmic reticulum kng04145   Phagosome Brite KEGG Orthology (KO) [BR:kng00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     KNAG_0H02920 (KNAG0H02920)    04141 Protein processing in endoplasmic reticulum     KNAG_0H02920 (KNAG0H02920)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     KNAG_0H02920 (KNAG0H02920)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:kng04131]     KNAG_0H02920 (KNAG0H02920)   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:kng02044]     KNAG_0H02920 (KNAG0H02920) Membrane trafficking [BR:kng04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     KNAG_0H02920 (KNAG0H02920) Secretion system [BR:kng02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    KNAG_0H02920 (KNAG0H02920) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecE Motif Other DBs NCBI-GeneID:  34527439 NCBI-ProteinID:  XP_022465952 UniProt:  J7S1X4 LinkDB All DBs Position 8:complement(541631..541843) Genome browser AA seq 70 aa AA seqDB search MAGEKGSEKQLLDTPLEFIRDGNQFLKKCKKPDTKEYFKIIRAVGIGFIAVGLIGYAIKL IHIPIRYVIV NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atggcaggtgaaaagggcagtgagaaacaactattggatactccattggagtttatcaga gatggtaaccaattcctaaagaagtgtaagaagcccgacaccaaagagtacttcaagatc attagagccgtgggcattggtttcatcgccgtcggtctgattggttatgctatcaaattg atccatattcctatcagatacgttattgtgtaa

DBGET integrated database retrieval system