Knoellia sp. S7-12: V6K52_14610 Help Entry V6K52_14610       CDS       T10549                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kno  Knoellia sp. S7-12 Pathway kno01100   Metabolic pathways kno01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kno00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     V6K52_14610    00074 Mycolic acid biosynthesis     V6K52_14610   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     V6K52_14610 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  XAU38466 LinkDB All DBs Position complement(3050168..3050419) Genome browser AA seq 83 aa AA seqDB search MGALSRDDLRNMMADVLSAQGKTIPAEDSAVLEQIGFRSLDFSELALRVEDEIGEELNFD APELRQIRTISDVLDFLEQLQAA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgggtgcactgagccgggacgacctccggaacatgatggctgacgttctgtctgcccag ggcaagaccattccggcagaggactcggccgttctggagcagatcggcttccggtcgctc gacttctccgagctggccctgcgtgttgaggacgagatcggcgaggaactcaacttcgac gctcccgagttgcgacagatccgcaccatctccgacgtgctcgacttcctcgagcagctg caagcagcgtga

DBGET integrated database retrieval system