Kingella oralis: H3L93_00890 Help Entry H3L93_00890       CDS       T06724                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism koa  Kingella oralis Pathway koa01100   Metabolic pathways koa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:koa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H3L93_00890    00074 Mycolic acid biosynthesis     H3L93_00890   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H3L93_00890 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QMT42959 LinkDB All DBs Position complement(172442..172708) Genome browser AA seq 88 aa AA seqDB search MNDLEHQIKQLIIDSLALEDITPADIGSEEPLFGDEGLGLDSVDALELGLAVQKTFGFQL DGENDNLRDNFANVKTLSEFVRSRQAQG NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgaacgacttagaacaccaaatcaaacaactcatcatcgacagccttgcgctggaagac atcacccccgccgacatcggcagcgaagagccgctgttcggcgacgaaggcttggggctg gattcggttgacgcgctggaactgggtttggcggtacaaaaaaccttcggcttccagctc gacggcgaaaacgacaacctgcgcgacaactttgccaacgtcaaaacgctgtccgaattt gtcagaagccgtcaggcacagggataa

DBGET integrated database retrieval system