Kosakonia sp. SMBL-WEM22: HF650_23905 Help Entry HF650_23905       CDS       T08549                                  Symbol rhaM Name (GenBank) L-rhamnose mutarotase   KO K03534   L-rhamnose mutarotase [EC:5.1.3.32] Organism kob  Kosakonia sp. SMBL-WEM22 Brite KEGG Orthology (KO) [BR:kob00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     HF650_23905 (rhaM) Enzymes [BR:kob01000]  5. Isomerases   5.1  Racemases and epimerases    5.1.3  Acting on carbohydrates and derivatives     5.1.3.32  L-rhamnose mutarotase      HF650_23905 (rhaM) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  rhaM Fucose_iso_C ABM Motif Other DBs NCBI-ProteinID:  QNQ22534 UniProt:  A0A7H0MJS3 LinkDB All DBs Position 4951881..4952195 Genome browser AA seq 104 aa AA seqDB search MIRKAFVMQVNPDAHEEYARRHNPIWPELEAVLKEAGAHHYAIYLDKARNLLFATVEIES EARWEAVARTEVCQRWWKHMRDVMPANADNSPVSTELEEVFYLA NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgatccgcaaagcgtttgttatgcaggtcaaccccgatgcgcatgaggagtacgcgcgt cgccataatccgatctggccggagctggaagcggtgctgaaagaggcgggcgcgcaccat tacgccatctatcttgataaagcgcgcaacctgctcttcgccacggtggagattgaatca gaagcgcgctgggaggcggttgcccgcacggaggtgtgccagcgctggtggaagcatatg cgcgacgtgatgcctgccaatgccgataacagcccggtaagcaccgagctggaagaggtg ttctatctggcgtaa

DBGET integrated database retrieval system