Klebsiella oxytoca CAV1374: AB185_24830 Help Entry AB185_24830       CDS       T04534                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism koc  Klebsiella oxytoca CAV1374 Pathway koc01100   Metabolic pathways koc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:koc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AB185_24830    00074 Mycolic acid biosynthesis     AB185_24830   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AB185_24830 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  AKL36933 UniProt:  A0A330IFA9 LinkDB All DBs Position complement(4136610..4136846) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttccttcgttgaagacctgggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcactactgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system