Kocuria sp. KD4: HBK84_01955 Help Entry HBK84_01955       CDS       T06521                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism kod  Kocuria sp. KD4 Brite KEGG Orthology (KO) [BR:kod00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:kod03032]     HBK84_01955    03036 Chromosome and associated proteins [BR:kod03036]     HBK84_01955    03400 DNA repair and recombination proteins [BR:kod03400]     HBK84_01955 DNA replication proteins [BR:kod03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     HBK84_01955 Chromosome and associated proteins [BR:kod03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     HBK84_01955 DNA repair and recombination proteins [BR:kod03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       HBK84_01955 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF2267 Motif Other DBs NCBI-ProteinID:  QIR68983 LinkDB All DBs Position 432783..433067 Genome browser AA seq 94 aa AA seqDB search MAMNRSELVAEVAEKSGSTQAAVNGVLDSLFQVFESSVSKGEKITIPGWLSVERTDRAAR QGRNPQTGEAIQIPAGHGVKLTAGSKLKAAVSSK NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggctatgaaccgcagcgaactcgttgcagaggttgccgagaagtccggtagcacccag gccgccgtcaacggcgttctcgactccctgttccaggttttcgagagctccgtttccaag ggcgagaagatcaccatccccggctggctctccgtggagcgcaccgaccgcgccgcgcgt cagggtcgcaacccgcagaccggcgaggccatccagatcccggctggacacggtgtcaag ctcactgcgggctccaagctgaaggctgctgtttcctccaagtga

DBGET integrated database retrieval system